This application implementats Alphafold3 on Biowulf. In addition to providing a convenient wrapper to run alphafold3 itself it also includes some tools (for example: convert fasta files into the required json input format and validate json input file formats) implemented by us.
Please also check our general guidance on alphafold-related applications.
af3
af3 convert
to convert basic fasta files with different types of sequences into af3 input json
files.lscratch
ALPHAFOLD3_MOUNTS
ALPHAFOLD3_IMAGE
$ALPHAFOLD3_TEST_DATA
/fdb/alphafold3/
module load alphafold3/3.0.1_largemem
Allocate an interactive session on a CPU node for generating MSAs.
Sample session (user input in bold) using the biowulf af3
wrapper:
[user@biowulf]$ sinteractive --mem=80g --cpus-per-task=12 --gres=lscratch:20 salloc.exe: Pending job allocation 46116226 salloc.exe: job 46116226 queued and waiting for resources salloc.exe: job 46116226 has been allocated resources salloc.exe: Granted job allocation 46116226 salloc.exe: Waiting for resource configuration salloc.exe: Nodes cn3144 are ready for job [user@cn3144 ~]$ module load alphafold3 [user@cn3144 ~]$ af3 --help Usage: af3 {convert,validate,run} [-h] [--completion COMPLETION] Subcommands convert Convert a set of fasta files to alphafold3 json input files. validate Validates alphafold3 json format input files. run Wrapper for running alphafold3 on Biowulf. Help [-h, --help] Show this message and exit. [--completion COMPLETION] Use --completion generate to print shell-specific completion source. Valid options: generate, complete.
Import a fasta file. In this example the fasta file contains 3 protein
subunits and 2 DNA sequences that form a double stranded fragment. The default
for af3 convert
is to assume that all sequences are protein
sequences so we have to use --guess
to instruct it to guess
sequence types. Note that specifying multiple seeds will run inference for each
trained model with each random seed. We use --norun_inference
to
only run the data processing pipeline in this first step.
[user@cn3144 ~]$ af3 convert --guess --output-dir af3_input --seeds 1,2,3,4,5 $ALPHAFOLD3_TEST_DATA/promo.fa [23:59:25] INFO processing promo.fa cli_convert.py:86 INFO - P20226: A[protein] cli_convert.py:101 INFO - YP_233025.1: B[protein] cli_convert.py:101 INFO - YP_233009.1: C[protein] cli_convert.py:101 INFO - i1l_intermediate_promoter: D[dna] cli_convert.py:101 INFO - i1l_intermediate_promoter_rc: E[dna] cli_convert.py:101 [user@cn3144 ~]$ af3 validate af3_input/promo.json [12:05:38] INFO OK: af3_input/promo.json [user@cn3144 ~]$ cat af3_input/promo.json { "name": "promo", "modelSeeds": [ 1, 2, 3, 4, 5 ], "dialect": "alphafold3", "version": 1, "sequences": [ { "protein": { "id": "A", "sequence": "MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT" } }, { "protein": { "id": "B", "sequence": "MDNLFTFLHEIEDRYARTIFNFHLISCDEIGDIYGLMKERISSEDMFDNIVYNKDIHPAIKKLVYCDIQLTKHIINQNTYPVFNDSSQVKCCHYFDINSDNSNISSRTVEIFEREKSSLVSYIKTTNKKRKVNYGEIKKTVHGGTNANYFSGKKSDEYLSTTVRSNINQPWIKTISKRMRVDIINHSIVTRGKSSILQTIEIIFTNRTCVKIFKDSTMHIILSKDKDEKGCIHMIDKLFYVYYNLFLLFEDIIQNEYFKEVANVVNHVLTATALDEKLFLIKKMAEHDVYGVSNFKIGMFNLTFIKSLDHTVFPSLLDEDSKIKFFKGKKLNIVALRSLEDCINYVTKSENMIEMMKERSTILNSIDIETESVDRLKELLLK" } }, { "protein": { "id": "C", "sequence": "MFEPVPDLNLEASVELGEVNIDQTTPMIKENSGFISRSRRLFAHRSKDDERKLALRFFLQRLYFLDHREIHYLFRCVDAVKDVTITKKNNIIVAPYIALLTIASKGCKLTETMIEAFFPELYNEHSKKFKFNSQVSIIQEKLGYQFGNYHVYDFEPYYSTVALAIRDEHSSGIFNIRQESYLVSSLSEITYRFYLINLKSDLVQWSASTGAVINQMVNTVLITVYEKLQLVIENDSQFTCSLAVESKLPIKLLKDRNELFTKFINELKKTSSFKISKRDKDTLLKYFT" } }, { "dna": { "id": "D", "sequence": "TTGTATTTAAAAGTTGTTTGGTGAACTTAAATGG" } }, { "dna": { "id": "E", "sequence": "CCATTTAAGTTCACCAAACAACTTTTAAATACAA" } } ] } [user@cn3144 ~]$ model=/path/to/model/dir [user@cn3144 ~]$ ls $model af3.bin.zst [user@cn3144 ~]$ af3 run --model_dir $model --output_dir=af3_model \ --json_path af3_input/promo.json --norun_inference Running AlphaFold 3. Please note that standard AlphaFold 3 model parameters are only available under terms of use provided at https://github.com/google-deepmind/alphafold3/blob/main/WEIGHTS_TERMS_OF_USE.md. If you do not agree to these terms and are using AlphaFold 3 derived model parameters, cancel execution of AlphaFold 3 inference with CTRL-C, and do not use the model parameters. Skipping running model inference. Processing 1 fold inputs. Processing fold input promo Running data pipeline... Processing chain A [...snip...] Processing chain A took 1931.94 seconds Processing chain B [...snip...] Processing chain B took 1344.49 seconds Processing chain C [...snip...] Processing chain C took 1353.66 seconds Processing chain D Processing chain D took 0.00 seconds Processing chain E Processing chain E took 0.00 seconds [user@cn3144 ~]$ tree af3_model af3_model/ └── [user 4.0K] promo └── [user 12M] promo_data.json 1 directory, 1 file [user@cn3144 ~]$ exit salloc.exe: Relinquishing job allocation 46116226 [user@biowulf ~]$
For this input the generation of MSAs took approximately 1.3h on a x9454 node. We are working on a tool for batch processing of alignments against reference data in lscratch. The data processing pipeline creates a new json file (see above) which includes the generated multiple sequence alignments. These input files can also be generated by any other data processing pipleine. See the alphafold3 documentation for more detail.
Next, for the model inference, we will use a A100 GPU. A100 or newer GPUs
are required for triton flash attention. On lower GPUs xla attention has to be
used. For inference we use --norun_data_pipeline
since we already
generated the MSAs in the previous step.
[user@biowulf]$ sinteractive --mem=20g --cpus-per-task=12 --gres=lscratch:20,gpu:a100:1 salloc.exe: Pending job allocation 46116227 salloc.exe: job 46116227 queued and waiting for resources salloc.exe: job 46116227 has been allocated resources salloc.exe: Granted job allocation 46116227 salloc.exe: Waiting for resource configuration salloc.exe: Nodes cn0073 are ready for job [user@cn0073 ~]$ module load alphafold3 [user@cn0073 ~]$ af3 run --norun_data_pipeline --json_path af3_model/promo/promo_data.json \ --model_dir $model --output_dir=./af3_model [...snip...] Featurising data for seeds (1, 2, 3, 4, 5)... [...snip...] Featurising data for seeds (1, 2, 3, 4, 5) took 73.36 seconds. Running model inference for seed 1... Running model inference and extracting output structures for seed 1 took 129.86 seconds. Running model inference for seed 2... Running model inference and extracting output structures for seed 2 took 100.20 seconds. Running model inference for seed 3... Running model inference and extracting output structures for seed 3 took 100.03 seconds. Running model inference for seed 4... Running model inference and extracting output structures for seed 4 took 100.11 seconds. Running model inference for seed 5... Running model inference and extracting output structures for seed 5 took 100.32 seconds. Running model inference and extracting output structures for seeds (1, 2, 3, 4, 5) took 530.52 seconds. Writing outputs for promo for seed(s) (1, 2, 3, 4, 5)... Done processing fold input promo. Done processing 1 fold inputs. [user@cn0073 ~]$ tree af3_model └── [user 4.0K] promo ├── [user 13K] TERMS_OF_USE.md ├── [user 624] ranking_scores.csv ├── [user 4.0K] seed-1_sample-0 │ ├── [user 9.1M] confidences.json │ ├── [user 725K] model.cif │ └── [user 621] summary_confidences.json [...snip...] ├── [user 4.0K] seed-5_sample-4 │ ├── [user 9.1M] confidences.json │ ├── [user 725K] model.cif │ └── [user 616] summary_confidences.json ├── [user 9.1M] promo_confidences.json ├── [user 12M] promo_data.json ├── [user 733K] promo_model.cif └── [user 618] promo_summary_confidences.json [user@cn0073 ~]$ cat af3_model/promo/ranking_scores.csv seed,sample,ranking_score 1,0,0.6383556805710533 1,1,0.6397741633924838 1,2,0.6374833859487241 1,3,0.6302300867657832 1,4,0.6246919848132091 2,0,0.6395896419775849 2,1,0.6211071934342338 2,2,0.6314571421329415 2,3,0.6559208263291473 2,4,0.6197578295821197 3,0,0.6493369799732224 3,1,0.6524003286557849 3,2,0.6585710305194263 3,3,0.6502327801866927 3,4,0.664610744023165 4,0,0.619652988060626 4,1,0.6237174764953402 4,2,0.6348252568772048 4,3,0.6297265192006525 4,4,0.6253496734254855 5,0,0.6508382745016786 5,1,0.6438060137920402 5,2,0.6284501912141062 5,3,0.6349033553455605 5,4,0.6352727254107549 [user@cn0073 ~]$ exit salloc.exe: Relinquishing job allocation 46116227 [user@biowulf ~]$
Create a batch input file (e.g. alphafold3.sh). For example:
#!/bin/bash # this is af3_aln.sh module load alphafold3/3.0.0 # copy locally. Not normally necessary but the test # data is not available from within the alphafold container cp ${ALPHAFOLD3_TEST_DATA}/t1049.json . model=path/to/your/model_dir af3 run \ --model_dir=$model \ --output_dir=aln \ --json_path=t1049.json \ --norun_inference \ -- --jackhmmer_n_cpu=6
Submit this job using the Slurm sbatch command.
[user@biowulf]$ jid=$(sbatch --cpus-per-task=12 --mem=80g --time=2:00:00 --gres=lscratch:20 af3_aln.sh) [user@biowulf]$ echo $jid
Then set up a dependent job to run model inference
#!/bin/bash # this is af3_inference.sh module load alphafold3/3.0.0 model=path/to/your/model_dir af3 run \ --model_dir=$model \ --output_dir=model \ --json_path=aln/t1049/t1049_data.json \ --norun_data_pipeline
[user@biowulf]$ sbatch --cpus-per-task=12 --mem=20g --time=2:00:00 --partition=gpu --gres=lscratch:20,gpu:a100:1 --dependency=${jid} af3_inference.sh # --dependency is only optional if MSA is ready from last step. Check details with: sbatch --help